PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G09230.1
Common NameAtMYB1, F3L24.10, MYB1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 393aa    MW: 42811.4 Da    PI: 5.2165
Description myb domain protein 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G09230.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.8e-1855100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEd+ l ++vk+lG ++W+ Iar ++ gR++k+c++rw + 
      AT3G09230.1  55 KGPWSKEEDDVLSELVKRLGARNWSFIARSIP-GRSGKSCRLRWCNQ 100
                      79******************************.***********985 PP

2Myb_DNA-binding51.72e-16107150146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++T+ Ed+ ++ a++ +G++ W+ Ia+ ++ gRt++ +k++w++
      AT3G09230.1 107 RNSFTEVEDQAIIAAHAIHGNK-WAVIAKLLP-GRTDNAIKNHWNS 150
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.81650105IPR017930Myb domain
SuperFamilySSF466891.09E-2952148IPR009057Homeodomain-like
SMARTSM007175.7E-1554103IPR001005SANT/Myb domain
PfamPF002498.9E-1755100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2356108IPR009057Homeodomain-like
CDDcd001674.06E-145799No hitNo description
PROSITE profilePS5129418.415106156IPR017930Myb domain
SMARTSM007175.7E-15106154IPR001005SANT/Myb domain
PfamPF002491.3E-14107150IPR001005SANT/Myb domain
CDDcd001674.64E-12109149No hitNo description
Gene3DG3DSA:1.10.10.601.9E-22109155IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009751Biological Processresponse to salicylic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MEAEIVRRSE VTGLRREVEE SSIGRGDCDG DGGDVGEDAA GFVGTSGRGR RDRVKGPWSK  60
EEDDVLSELV KRLGARNWSF IARSIPGRSG KSCRLRWCNQ LNPNLIRNSF TEVEDQAIIA  120
AHAIHGNKWA VIAKLLPGRT DNAIKNHWNS ALRRRFIDFE KAKNIGTGSL VVDDSGFDRT  180
TTVASSEETL SSGGGCHVTT PIVSPEGKEA TTSMEMSEEQ CVEKTNGEGI SRQDDKDPPT  240
LFRPVPRLSS FNACNHMEGS PSPHIQDQNQ LQSSKQDAAM LRLLEGAYSE RFVPQTCGGG  300
CCSNNPDGSF QQESLLGPEF VDYLDSPTFP SSELAAIATE IGSLAWLRSG LESSSVRVME  360
DAVGRLRPQG SRGHRDHYLV SEQGTNITNV LST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-40491551107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.501620.0flower
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT3G09230
AtGenExpressAT3G09230
Functional Description ? help Back to Top
Source Description
TAIRmember of MYB3R- and R2R3- type MYB- encoding genes
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G09230.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDsalicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G09230
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5502950.0AY550295.1 Arabidopsis thaliana MYB transcription factor (At3g09230) mRNA, complete cds.
GenBankBT0264290.0BT026429.1 Arabidopsis thaliana At3g09230 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187534.10.0myb domain protein 1
TrEMBLQ425750.0Q42575_ARATH; ATMYB1 protein
STRINGAT3G09230.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84922636
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Ramirez-Parra E,Fr
    A genome-wide identification of E2F-regulated genes in Arabidopsis.
    Plant J., 2003. 33(4): p. 801-11
    [PMID:12609051]
  4. Shinozaki K,Yamaguchi-Shinozaki K,Urao T,Koizumi M
    Nucleotide sequence of a gene from Arabidopsis thaliana encoding a myb homologue.
    Plant Mol. Biol., 1992. 19(3): p. 493-9
    [PMID:1623193]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]